Glucose-6-Phosphate Dehydrogenase antibody
-
- Target See all Glucose-6-Phosphate Dehydrogenase (G6PD) Antibodies
- Glucose-6-Phosphate Dehydrogenase (G6PD)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glucose-6-Phosphate Dehydrogenase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- H6 PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
- Top Product
- Discover our top product G6PD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
H6PD Blocking Peptide, catalog no. 33R-3729, is also available for use as a blocking control in assays to test for specificity of this H6PD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 D antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucose-6-Phosphate Dehydrogenase (G6PD)
- Alternative Name
- H6PD (G6PD Products)
- Synonyms
- G6PD1 antibody, g6pd antibody, G6pd antibody, G6pdx antibody, g6pdh antibody, g6pd2 antibody, fj78b06 antibody, wu:fj78b06 antibody, si:dkey-90a13.8 antibody, BA3433 antibody, CORTRD1 antibody, G6PDH antibody, GDH antibody, G28A antibody, G6PD antibody, Gpdx antibody, glucose-6-phosphate dehydrogenase antibody, glucose-6-phosphate 1-dehydrogenase antibody, glucose-6-phosphate 1-dehydrogenase (G6PD) antibody, glucose-6-P dehydrogenase antibody, glucose-6-phosphate dehydrogenase L homeolog antibody, glucose-6-phosphate 1-dehydrogenase Zwf antibody, hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase antibody, glucose-6-phosphate dehydrogenase X-linked antibody, G6PD antibody, g6pd antibody, g6pD antibody, zwf antibody, LOC100120232 antibody, LACBIDRAFT_188936 antibody, G6pd antibody, g6pd.L antibody, CNG03280 antibody, Tb10.70.5200 antibody, H6PD antibody, G6pdx antibody, H6pd antibody
- Background
- There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.
- Molecular Weight
- 89 kDa (MW of target protein)
- Pathways
- Regulation of Systemic Arterial Blood Pressure by Hormones
-