FGL1 antibody (Middle Region)
-
- Target See all FGL1 Antibodies
- FGL1 (Fibrinogen-Like 1 (FGL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FGL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FGL1 antibody was raised against the middle region of FGL1
- Purification
- Affinity purified
- Immunogen
- FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL
- Top Product
- Discover our top product FGL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FGL1 Blocking Peptide, catalog no. 33R-2413, is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGL1 (Fibrinogen-Like 1 (FGL1))
- Alternative Name
- FGL1 (FGL1 Products)
- Synonyms
- MGC84748 antibody, FGL1 antibody, DKFZp470A2333 antibody, Frep1 antibody, Lfire1 antibody, HFREP1 antibody, HP-041 antibody, LFIRE-1 antibody, LFIRE1 antibody, Mfire1 antibody, fibrinogen like 1 L homeolog antibody, fibrinogen like 1 antibody, fibrinogen-like 1 antibody, fibrinogen-like protein 1 antibody, fgl1.L antibody, FGL1 antibody, Fgl1 antibody
- Background
- Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.
- Molecular Weight
- 34 kDa (MW of target protein)
-