RNASE11 antibody
-
- Target See all RNASE11 Antibodies
- RNASE11 (Ribonuclease, RNase A Family, 11 (Non-Active) (RNASE11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNASE11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNASE11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL
- Top Product
- Discover our top product RNASE11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNASE11 Blocking Peptide, catalog no. 33R-3344, is also available for use as a blocking control in assays to test for specificity of this RNASE11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASE11 (Ribonuclease, RNase A Family, 11 (Non-Active) (RNASE11))
- Alternative Name
- RNASE11 (RNASE11 Products)
- Synonyms
- C14orf6 antibody, ribonuclease A family member 11 antibody, ribonuclease A family member 11 (inactive) antibody, ribonuclease, RNase A family, 11 (non-active) antibody, Rnase11 antibody, RNASE11 antibody
- Background
- RNASE11 belongs to the pancreatic ribonuclease family. The function of RNASE11 remains unknown.
- Molecular Weight
- 22 kDa (MW of target protein)
-