Gelsolin antibody
-
- Target See all Gelsolin (GSN) Antibodies
- Gelsolin (GSN)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Gelsolin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Gelsolin antibody was raised using a synthetic peptide corresponding to a region with amino acids KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
- Top Product
- Discover our top product GSN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Gelsolin Blocking Peptide, catalog no. 33R-4591, is also available for use as a blocking control in assays to test for specificity of this Gelsolin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Gelsolin (GSN)
- Alternative Name
- Gelsolin (GSN Products)
- Synonyms
- ADF antibody, AGEL antibody, CG1106 antibody, DGS antibody, Dmel\\CG1106 antibody, gel antibody, scin antibody, cb107 antibody, gsn antibody, sb:cb107 antibody, u-gelsolin antibody, wu:fi16f06 antibody, gelsolin antibody, Gelsolin antibody, gelsolin S homeolog antibody, gelsolin a antibody, GSN antibody, Gel antibody, Gsn antibody, gsn.S antibody, gsn antibody, gsna antibody
- Background
- GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).
- Molecular Weight
- 83 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization, Autophagy
-