Gelsolin antibody

Catalog No. ABIN633981

Product Details anti-Gelsolin Antibody

Target: Gelsolin (GSN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Gelsolin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Gelsolin antibody was raised using a synthetic peptide corresponding to a region with amino acids KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Gelsolin Blocking Peptide, catalog no. 33R-4591, is also available for use as a blocking control in assays to test for specificity of this Gelsolin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Gelsolin

Target: Gelsolin (GSN)

Alternative Name: Gelsolin (GSN Products)

Synonyms: ADF antibody, AGEL antibody, CG1106 antibody, DGS antibody, Dmel\\CG1106 antibody, gel antibody, scin antibody, cb107 antibody, gsn antibody, sb:cb107 antibody, u-gelsolin antibody, wu:fi16f06 antibody, gelsolin antibody, Gelsolin antibody, gelsolin S homeolog antibody, gelsolin a antibody, GSN antibody, Gel antibody, Gsn antibody, gsn.S antibody, gsn antibody, gsna antibody

Background: GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).

Molecular Weight: 83 kDa (MW of target protein)

Pathways: Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization, Autophagy