AGR2 antibody
-
- Target See all AGR2 Antibodies
- AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY
- Top Product
- Discover our top product AGR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AGR2 Blocking Peptide, catalog no. 33R-1144, is also available for use as a blocking control in assays to test for specificity of this AGR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))
- Alternative Name
- AGR2 (AGR2 Products)
- Synonyms
- AG2 antibody, GOB-4 antibody, HAG-2 antibody, PDIA17 antibody, XAG-2 antibody, Agr2h antibody, Gob-4 antibody, mAG-2 antibody, wu:fj29g05 antibody, zgc:112187 antibody, agr2 antibody, hag3 antibody, hag-3 antibody, bcmp11 antibody, MGC89004 antibody, XAgr2 antibody, agr2-A antibody, anterior gradient 2, protein disulphide isomerase family member antibody, anterior gradient 2 antibody, anterior gradient 3, protein disulphide isomerase family member antibody, anterior gradient 2, protein disulphide isomerase family member S homeolog antibody, AGR2 antibody, Agr2 antibody, agr2 antibody, agr3 antibody, agr2.S antibody
- Background
- AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.
- Molecular Weight
- 20 kDa (MW of target protein)
-