KIF2A antibody (Middle Region)
-
- Target See all KIF2A Antibodies
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF2 A antibody was raised against the middle region of KIF2
- Purification
- Affinity purified
- Immunogen
- KIF2 A antibody was raised using the middle region of KIF2 corresponding to a region with amino acids DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL
- Top Product
- Discover our top product KIF2A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF2A Blocking Peptide, catalog no. 33R-2186, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
- Alternative Name
- KIF2A (KIF2A Products)
- Synonyms
- HK2 antibody, KIF2 antibody, C530030B14Rik antibody, Kif2 antibody, Kns2 antibody, M-kinesin antibody, kif2-a antibody, fj55b02 antibody, wu:fj55b02 antibody, kinesin family member 2A antibody, kinesin heavy chain member 2A L homeolog antibody, kinesin heavy chain member 2A antibody, zgc:103670 antibody, Kinesin-2 antibody, KIF2A antibody, Kif2a antibody, kif2a.L antibody, zgc:103670 antibody, GL50803_17333 antibody, GL50803_16456 antibody
- Background
- KIF2A plus end-directed microtubule-dependent motor is required for normal brain development. KIF2A may regulate microtubule dynamics during axonal growth and has microtubule depolymerization activity. The protein is implicated in formation of bipolar mitotic spindles. Kinesins, such as KIF2, are microtubule-associated motor proteins. For background information on kinesins.
- Molecular Weight
- 80 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, Ribonucleoprotein Complex Subunit Organization
-