RPA1 antibody (Middle Region)

Catalog No. ABIN634119

Product Details anti-RPA1 Antibody

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPA1 antibody was raised against the middle region of RPA1

Purification: Affinity purified

Immunogen: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPA1 Blocking Peptide, catalog no. 33R-9194, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPA1

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Alternative Name: RPA1 (RPA1 Products)

Synonyms: HSSB antibody, MST075 antibody, REPA1 antibody, RF-A antibody, RP-A antibody, RPA70 antibody, Cb1-727 antibody, wu:fi14b08 antibody, zgc:55337 antibody, zgc:77092 antibody, RPA1 antibody, hssb antibody, mst075 antibody, repa1 antibody, rf-a antibody, rp-a antibody, rpa antibody, rpa70 antibody, LOC100230990 antibody, 5031405K23Rik antibody, 70kDa antibody, AA589576 antibody, AW557552 antibody, Rpa antibody, CG9633 antibody, D-RPA70 antibody, D-SSB antibody, DRP-A antibody, DmRPA antibody, Dmel\\CG9633 antibody, RPA antibody, RPA 70 antibody, RPA 70 kDa antibody, RpA70 antibody, Rpa-70 antibody, Ssb-70 antibody, dRP-A antibody, dmrpa1 antibody, i164 antibody, replication protein A1 antibody, replication protein A1, 70kDa antibody, replication protein A1 L homeolog antibody, Replication Protein A 70 antibody, RPA1 antibody, Rpa1 antibody, rpa1 antibody, rpa1.L antibody, RpA-70 antibody

Background: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA