PLK1 antibody

Catalog No. ABIN634136

The Rabbit Polyclonal anti-PLK1 antibody is suitable to detect PLK1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for PLK1 antibody (ABIN634136)

Target: PLK1 (Polo-Like Kinase 1 (PLK1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLK1 Antibody

Purification: Affinity purified

Immunogen: PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLK1 Blocking Peptide, (ABIN940005), is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLK1

Target: PLK1 (Polo-Like Kinase 1 (PLK1))

Alternative Name: PLK1

Background: Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Cell Division Cycle, M Phase