BTG4 antibody (Middle Region)
-
- Target See all BTG4 Antibodies
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BTG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BTG4 antibody was raised against the middle region of BTG4
- Purification
- Affinity purified
- Immunogen
- BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
- Top Product
- Discover our top product BTG4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
- Alternative Name
- BTG4 (BTG4 Products)
- Synonyms
- SCIR-27 antibody, b9-a antibody, pc3b antibody, C86116 antibody, PC3B antibody, BTG anti-proliferation factor 4 antibody, BTG family member 4 L homeolog antibody, B cell translocation gene 4 antibody, Btg4 antibody, btg4.L antibody, BTG4 antibody
- Background
- The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
- Molecular Weight
- 26 kDa (MW of target protein)
-