Septin 2 antibody (Middle Region)
-
- Target See all Septin 2 (SEPT2) Antibodies
- Septin 2 (SEPT2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Septin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Septin 2 antibody was raised against the middle region of 40423
- Purification
- Affinity purified
- Immunogen
- Septin 2 antibody was raised using the middle region of 40423 corresponding to a region with amino acids LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI
- Top Product
- Discover our top product SEPT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Septin 2 Blocking Peptide, catalog no. 33R-5309, is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 37500 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 2 (SEPT2)
- Alternative Name
- Septin 2 (SEPT2 Products)
- Synonyms
- DIFF6 antibody, NEDD5 antibody, Pnutl3 antibody, hNedd5 antibody, AW208991 antibody, Nedd-5 antibody, Nedd5 antibody, mKIAA0158 antibody, Vesp11 antibody, nedd5 antibody, wu:fb52g01 antibody, wu:fb99a01 antibody, Septin-2A antibody, Septin-A antibody, diff6 antibody, pnutl3 antibody, sept2 antibody, septa antibody, xlsepta antibody, SEPT2 antibody, Sep-02 antibody, Septin-2B antibody, hnedd5 antibody, sept2-B antibody, Septin-2 antibody, septin 2 antibody, septin 2 L homeolog antibody, septin 2-like antibody, COG1487; VapC; putative nucleic acid-binding protein; contains PIN domain antibody, septin 2 S homeolog antibody, SEPT2 antibody, Sept2 antibody, sept2 antibody, sept2.L antibody, SEPT2L antibody, sepT2 antibody, sept2.S antibody
- Background
- SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
- Molecular Weight
- 41 kDa (MW of target protein)
-