ACPP antibody (Middle Region)

Catalog No. ABIN634280

Product Details anti-ACPP Antibody

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACPP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACPP antibody was raised against the middle region of ACPP

Purification: Affinity purified

Immunogen: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACPP Blocking Peptide, catalog no. 33R-1679, is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACPP

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Alternative Name: ACPP (ACPP Products)

Synonyms: 5'-NT antibody, ACP-3 antibody, ACP3 antibody, PAP antibody, AMAP2 antibody, CENTB3 antibody, DDEF2 antibody, PAG3 antibody, Pap-alpha antibody, SHAG1 antibody, A030005E02Rik antibody, FRAP antibody, Lap antibody, Ppal antibody, Acpp11 antibody, RNACPP11 antibody, pap antibody, ACPP antibody, acp-3 antibody, acp3 antibody, acpt antibody, acid phosphatase, prostate antibody, ArfGAP with SH3 domain, ankyrin repeat and PH domain 2 antibody, prostatic acid phosphatase antibody, prostatic acid phosphatase, putative antibody, acid phosphatase, prostate S homeolog antibody, ACPP antibody, ASAP2 antibody, Acpp antibody, CpipJ_CPIJ004002 antibody, Smp_016640 antibody, acpp.S antibody

Background: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process