SQSTM1 antibody (Middle Region)

Catalog No. ABIN634293

The Rabbit Polyclonal anti-SQSTM1 antibody (ABIN634293) specifically detects SQSTM1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SQSTM1 antibody (Middle Region) (ABIN634293)

Target: SQSTM1 (Sequestosome 1 (SQSTM1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SQSTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SQSTM1 Antibody

Binding Specificity: Middle Region

Specificity: Sequestosome 1 antibody was raised against the middle region of SQSTM1

Purification: Affinity purified

Immunogen: Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sequestosome 1 Blocking Peptide, (ABIN937769), is also available for use as a blocking control in assays to test for specificity of this Sequestosome 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQSTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SQSTM1

Target: SQSTM1 (Sequestosome 1 (SQSTM1))

Alternative Name: Sequestosome 1

Background: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Neurotrophin Signaling Pathway, Autophagy