ADA antibody (Middle Region)
-
- Target See all ADA Antibodies
- ADA (Adenosine Deaminase (ADA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADA antibody was raised against the middle region of ADA
- Purification
- Affinity purified
- Immunogen
- ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE
- Top Product
- Discover our top product ADA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADA Blocking Peptide, catalog no. 33R-1412, is also available for use as a blocking control in assays to test for specificity of this ADA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADA (Adenosine Deaminase (ADA))
- Alternative Name
- ADA (ADA Products)
- Synonyms
- ADA-like antibody, xada antibody, ADA antibody, CG11994 antibody, Dmel\\CG11994 antibody, DrosADA antibody, dADA antibody, zgc:92028 antibody, adenosine deaminase antibody, adenosine deaminase S homeolog antibody, Adenosine deaminase antibody, ADA antibody, Ada antibody, ada.S antibody, ada antibody
- Background
- ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process
-