Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

JAK3 antibody

Antigen

JAK3

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634320
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen JAK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF
Description JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).
Molecular Weight 125 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAK3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Cytokines, Receptors, Kinases/Phosphatases

Alternatives

Alternatives for antigen "JAK3", type "Antibodies"
Hosts Mouse (6), Rabbit (4)
Reactivities Human (10), Mouse (Murine) (4), Rat (Rattus) (3)
Applications Western Blotting (WB) (6), ELISA (5), Immunofluorescence (IF) (4), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1)
Epitopes Ab-785 (1), pTyr785 (1)