-
- Target See all NEK6 Antibodies
- NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEK6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
- Top Product
- Discover our top product NEK6 Primary Antibody
-
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) antibody
NEK6 Reactivity: Human WB, IHC, IHC (p), IP Host: Mouse Monoclonal 2H7 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 251-280), (C-Term) antibodyNEK6 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB34648 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (N-Term) antibodyNEK6 Reactivity: Human, Monkey IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) antibodyNEK6 Reactivity: Human WB, IHC Host: Rabbit Monoclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 8-39), (N-Term) antibodyNEK6 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal RB2965 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 1-100) antibodyNEK6 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 1-100) antibodyNEK6 Reactivity: Human ELISA, IF Host: Mouse Monoclonal 3B5 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 38-87) antibodyNEK6 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Guinea Pig, Horse, Monkey, Bat, Chicken, Pig WB Host: Rabbit Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (N-Term) antibodyNEK6 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NEK6 Blocking Peptide, catalog no. 33R-3041, is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))
- Alternative Name
- NEK6 (NEK6 Products)
- Synonyms
- 1300007C09Rik antibody, si:ch211-167p9.4 antibody, ATNEK5 antibody, MOE17.17 antibody, NIMA-RELATED KINASE5 antibody, NIMA-related kinase 5 antibody, SID6-1512 antibody, NIMA (never in mitosis gene a)-related expressed kinase 6 antibody, NIMA-related kinase 6 antibody, NIMA related kinase 6 antibody, Serine/Threonine kinase catalytic domain protein antibody, NIMA-related kinase 6 S homeolog antibody, Nek6 antibody, nek6 antibody, NEK6 antibody, NEK5 antibody, nek6.S antibody
- Background
- The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.
- Molecular Weight
- 36 kDa (MW of target protein)
-
You are here:
