CAP1 antibody
-
- Target See all CAP1 Antibodies
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL
- Top Product
- Discover our top product CAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAP1 Blocking Peptide, catalog no. 33R-5624, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
- Alternative Name
- CAP1 (CAP1 Products)
- Synonyms
- CAP antibody, CAP1-PEN antibody, CAP1 antibody, DKFZp459E1319 antibody, cap1 antibody, Mch1 antibody, fj98f01 antibody, zgc:63872 antibody, wu:fj98f01 antibody, cyclase associated actin cytoskeleton regulatory protein 1 antibody, adenylyl cyclase-associated protein 1 antibody, Cap1 CAP, adenylate cyclase-associated protein 1 antibody, CAP, adenylate cyclase-associated protein 1 (yeast) antibody, adenylate cyclase associated protein 1 antibody, adenylyl cyclase-associated protein Cap1 antibody, CAP1 antibody, LOC5580331 antibody, cap1 antibody, Cap1 antibody
- Background
- The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-