DDAH1 antibody (Middle Region)
-
- Target See all DDAH1 Antibodies
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDAH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DDAH1 antibody was raised against the middle region of DDAH1
- Purification
- Affinity purified
- Immunogen
- DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
- Top Product
- Discover our top product DDAH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDAH1 Blocking Peptide, catalog no. 33R-1330, is also available for use as a blocking control in assays to test for specificity of this DDAH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
- Alternative Name
- DDAH1 (DDAH1 Products)
- Synonyms
- DDAH antibody, 2410006N07Rik antibody, 2510015N06Rik antibody, AI987801 antibody, AW050362 antibody, DDAH1 antibody, wu:fc30c11 antibody, zgc:85829 antibody, dimethylarginine dimethylaminohydrolase 1 antibody, dimethylarginine dimethylaminohydrolase 1 L homeolog antibody, DDAH1 antibody, Ddah1 antibody, ddah1.L antibody, ddah1 antibody
- Background
- DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
- Molecular Weight
- 31 kDa (MW of target protein)
-