Uromodulin antibody (Middle Region)
-
- Target See all Uromodulin (UMOD) Antibodies
- Uromodulin (UMOD)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Uromodulin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Uromodulin antibody was raised against the middle region of UMOD
- Purification
- Affinity purified
- Immunogen
- Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM
- Top Product
- Discover our top product UMOD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Uromodulin Blocking Peptide, catalog no. 33R-6556, is also available for use as a blocking control in assays to test for specificity of this Uromodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMOD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Uromodulin (UMOD)
- Alternative Name
- Uromodulin (UMOD Products)
- Synonyms
- ADMCKD2 antibody, FJHN antibody, HNFJ antibody, HNFJ1 antibody, MCKD2 antibody, THGP antibody, THP antibody, urehr4 antibody, uromodulin antibody, UMOD antibody, Umod antibody
- Background
- This gene encodes uromodulin, the most abundant protein in normal urine.
- Molecular Weight
- 67 kDa (MW of target protein)
-