Uromodulin antibody (Middle Region)

Catalog No. ABIN634373

Product Details anti-Uromodulin Antibody

Target: Uromodulin (UMOD)

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Uromodulin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Uromodulin antibody was raised against the middle region of UMOD

Purification: Affinity purified

Immunogen: Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Uromodulin Blocking Peptide, catalog no. 33R-6556, is also available for use as a blocking control in assays to test for specificity of this Uromodulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMOD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Uromodulin

Target: Uromodulin (UMOD)

Alternative Name: Uromodulin (UMOD Products)

Synonyms: ADMCKD2 antibody, FJHN antibody, HNFJ antibody, HNFJ1 antibody, MCKD2 antibody, THGP antibody, THP antibody, urehr4 antibody, uromodulin antibody, UMOD antibody, Umod antibody

Background: This gene encodes uromodulin, the most abundant protein in normal urine.

Molecular Weight: 67 kDa (MW of target protein)