SGK3 antibody (N-Term)

Catalog No. ABIN634419

Product Details anti-SGK3 Antibody

Target: SGK3 (serum/glucocorticoid Regulated Kinase Family, Member 3 (SGK3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SGK3 antibody was raised against the N terminal of SGK3

Purification: Affinity purified

Immunogen: SGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGK3 Blocking Peptide, catalog no. 33R-5569, is also available for use as a blocking control in assays to test for specificity of this SGK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGK3

Target: SGK3 (serum/glucocorticoid Regulated Kinase Family, Member 3 (SGK3))

Alternative Name: SGK3 (SGK3 Products)

Synonyms: CISK antibody, SGK2 antibody, SGKL antibody, 2510015P22Rik antibody, A330005P07Rik antibody, Cisk antibody, fy antibody, fz antibody, Sgkl antibody, zgc:162253 antibody, serum/glucocorticoid regulated kinase family member 3 antibody, serum/glucocorticoid regulated kinase 3 antibody, serum/glucocorticoid regulated kinase family, member 3 antibody, serine/threonine-protein kinase Sgk3 antibody, SGK3 antibody, Sgk3 antibody, LOC464217 antibody, sgk3 antibody, LOC100231693 antibody, LOC100343709 antibody, LOC100052030 antibody, LOC100521447 antibody

Background: This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molecular Weight: 53 kDa (MW of target protein)