RAB11B antibody (C-Term)
-
- Target See all RAB11B Antibodies
- RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB11B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAB11 B antibody was raised against the C terminal of RAB11
- Purification
- Affinity purified
- Immunogen
- RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
- Top Product
- Discover our top product RAB11B Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB11B Blocking Peptide, catalog no. 33R-3953, is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))
- Alternative Name
- RAB11B (RAB11B Products)
- Synonyms
- zgc:92772 antibody, H-YPT3 antibody, A730055L17Rik antibody, rab11b antibody, wu:fb07g11 antibody, zgc:55760 antibody, RAB11B, member RAS oncogene family, b antibody, RAB11B, member RAS oncogene family antibody, RAB11B, member RAS oncogene family, a antibody, RAB11B, member RAS oncogene family, gene 1 S homeolog antibody, rab11bb antibody, RAB11B antibody, Rab11b antibody, rab11ba antibody, rab11b.1.S antibody
- Background
- RAB11B possesses GTPase activity.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Hormone Transport, Carbohydrate Homeostasis
-