CXCR2 antibody (N-Term)

Catalog No. ABIN634514

Product Details anti-CXCR2 Antibody

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL8 RB antibody was raised against the N terminal of IL8 B

Purification: Affinity purified

Immunogen: IL8 RB antibody was raised using the N terminal of IL8 B corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL8RB Blocking Peptide, catalog no. 33R-5899, is also available for use as a blocking control in assays to test for specificity of this IL8RB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXCR2

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Alternative Name: IL8RB (CXCR2 Products)

Synonyms: CD182 antibody, CDw128b antibody, CMKAR2 antibody, IL8R2 antibody, IL8RA antibody, IL8RB antibody, CXC-R2 antibody, CXCR-2 antibody, CD128 antibody, CDw128 antibody, Cmkar2 antibody, Gpcr16 antibody, IL-8Rh antibody, IL-8rb antibody, Il8rb antibody, mIL-8RH antibody, C-X-C motif chemokine receptor 2 antibody, chemokine (C-X-C motif) receptor 2 antibody, Cxcr2 antibody, CXCR2 antibody

Background: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process