Selenoprotein S antibody (Middle Region)

Catalog No. ABIN634546

This Rabbit Polyclonal antibody specifically detects Selenoprotein S in WB. It exhibits reactivity toward Human.

Quick Overview for Selenoprotein S antibody (Middle Region) (ABIN634546)

Target: Selenoprotein S (SELS)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Selenoprotein S antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Selenoprotein S Antibody

Binding Specificity: Middle Region

Specificity: SELS antibody was raised against the middle region of SELS

Purification: Affinity purified

Immunogen: SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SELS Blocking Peptide, (ABIN5616036), is also available for use as a blocking control in assays to test for specificity of this SELS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Selenoprotein S

Target: Selenoprotein S (SELS)

Alternative Name: SELS

Background: SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling, SARS-CoV-2 Protein Interactome