RPSA/Laminin Receptor antibody (Middle Region)
-
- Target See all RPSA/Laminin Receptor (RPSA) Antibodies
- RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPSA/Laminin Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPSA antibody was raised against the middle region of RPSA
- Purification
- Affinity purified
- Immunogen
- RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
- Top Product
- Discover our top product RPSA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPSA Blocking Peptide, catalog no. 33R-9077, is also available for use as a blocking control in assays to test for specificity of this RPSA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPSA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))
- Alternative Name
- RPSA (RPSA Products)
- Synonyms
- 37LRP antibody, 67LR antibody, LBP/p40 antibody, LRP/LR antibody, LamR antibody, rpsa antibody, LamR1 antibody, RPSA antibody, LAMBR antibody, LAMR1 antibody, LBP antibody, LRP antibody, NEM/1CHD4 antibody, SA antibody, lamR antibody, p40 antibody, 67kDa antibody, 67lr antibody, AL022858 antibody, Lamr antibody, Lamr1 antibody, Lamrl1 antibody, MLR antibody, P40 antibody, P40-3 antibody, P40-8 antibody, lamr1 antibody, zgc:55831 antibody, zgc:77824 antibody, DMRT1 antibody, 40S ribosomal protein SA antibody, 67kD laminin receptor antibody, ribosomal protein SA antibody, rssa antibody, rpsa antibody, RPSA antibody, Rpsa antibody, LOC100144340 antibody
- Background
- RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-