IGFALS antibody (Middle Region)
-
- Target See all IGFALS Antibodies
- IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGFALS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGFALS antibody was raised against the middle region of IGFALS
- Purification
- Affinity purified
- Immunogen
- IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
- Top Product
- Discover our top product IGFALS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGFALS Blocking Peptide, catalog no. 33R-7116, is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFALS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))
- Alternative Name
- IGFALS (IGFALS Products)
- Synonyms
- ALS antibody, Albs antibody, mKIAA4111 antibody, Als antibody, insulin like growth factor binding protein acid labile subunit antibody, insulin like growth factor binding protein acid labile subunit L homeolog antibody, insulin-like growth factor binding protein, acid labile subunit antibody, IGFALS antibody, igfals.L antibody, Igfals antibody
- Background
- IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.
- Molecular Weight
- 63 kDa (MW of target protein)
-