Osteomodulin antibody (Middle Region)
-
- Target See all Osteomodulin (OMD) Antibodies
- Osteomodulin (OMD)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Osteomodulin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Osteomodulin antibody was raised against the middle region of OMD
- Purification
- Affinity purified
- Immunogen
- Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
- Top Product
- Discover our top product OMD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Osteomodulin (OMD)
- Alternative Name
- Osteomodulin (OMD Products)
- Synonyms
- si:ch211-103f16.5 antibody, OMD antibody, OSAD antibody, SLRR2C antibody, osteomodulin antibody, omd antibody, OMD antibody, Omd antibody
- Background
- OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-