Laminin beta 3 antibody (Middle Region)
-
- Target See all Laminin beta 3 (LAMB3) Antibodies
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Laminin beta 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Laminin Beta 3 antibody was raised against the middle region of LAMB3
- Purification
- Affinity purified
- Immunogen
- Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
- Top Product
- Discover our top product LAMB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Laminin Beta 3 Blocking Peptide, catalog no. 33R-2696, is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
- Alternative Name
- Laminin beta 3 (LAMB3 Products)
- Synonyms
- LAMB3 antibody, lam5 antibody, lamnb1 antibody, BM600-125KDA antibody, LAM5 antibody, LAMNB1 antibody, laminin subunit beta 3 antibody, laminin, beta 3 antibody, LAMB3 antibody, lamb3 antibody, Lamb3 antibody
- Background
- The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.
- Molecular Weight
- 128 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-