Laminin beta 3 antibody (Middle Region)

Catalog No. ABIN634648

Product Details anti-Laminin beta 3 Antibody

Target: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Laminin beta 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Laminin Beta 3 antibody was raised against the middle region of LAMB3

Purification: Affinity purified

Immunogen: Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Laminin Beta 3 Blocking Peptide, catalog no. 33R-2696, is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Laminin beta 3

Target: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Alternative Name: Laminin beta 3 (LAMB3 Products)

Synonyms: LAMB3 antibody, lam5 antibody, lamnb1 antibody, BM600-125KDA antibody, LAM5 antibody, LAMNB1 antibody, laminin subunit beta 3 antibody, laminin, beta 3 antibody, LAMB3 antibody, lamb3 antibody, Lamb3 antibody

Background: The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.

Molecular Weight: 128 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation