ROM1 antibody (Middle Region)

Catalog No. ABIN634680

Product Details anti-ROM1 Antibody

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ROM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ROM1 antibody was raised against the middle region of ROM1

Purification: Affinity purified

Immunogen: ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ROM1 Blocking Peptide, catalog no. 33R-6819, is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ROM1

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Alternative Name: ROM1 (ROM1 Products)

Synonyms: ROM antibody, ROSP1 antibody, RP7 antibody, TSPAN23 antibody, ROM1 antibody, M101156 antibody, Rgsc1156 antibody, Rom-1 antibody, Rosp1 antibody, Tspan23 antibody, rds35 antibody, rom antibody, rosp1 antibody, tspan23 antibody, Rds antibody, zgc:56548 antibody, zgc:73336 antibody, zgc:77401 antibody, retinal outer segment membrane protein 1 antibody, rod outer segment membrane protein 1 antibody, retinal outer segment membrane protein 1 L homeolog antibody, retinal outer segment membrane protein 1b antibody, retinal outer segment membrane protein 1a antibody, ROM1 antibody, Rom1 antibody, rom1.L antibody, rom1b antibody, rom1a antibody

Background: ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

Molecular Weight: 37 kDa (MW of target protein)