Claudin 5 antibody

Catalog No. ABIN634710

Product Details anti-Claudin 5 Antibody

Target: Claudin 5 (CLDN5)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 5 Blocking Peptide, catalog no. 33R-3663, is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 5

Target: Claudin 5 (CLDN5)

Alternative Name: Claudin 5 (CLDN5 Products)

Synonyms: AWAL antibody, BEC1 antibody, CPETRL1 antibody, TMVCF antibody, cld5 antibody, awal antibody, bec1 antibody, claudin-5 antibody, cpetrl1 antibody, tmvcf antibody, AI854493 antibody, MBEC1 antibody, Tmvcf antibody, cldn5 antibody, zgc:85723 antibody, zgc:103419 antibody, claudin 5 antibody, Claudin-5 antibody, claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) antibody, claudin 5a antibody, claudin 5b antibody, claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog antibody, CLDN5 antibody, cld5 antibody, cldn5 antibody, Cldn5 antibody, cldn5a antibody, cldn5b antibody, cldn5.L antibody

Background: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Hepatitis C