AGT antibody

Catalog No. ABIN634787

The Rabbit Polyclonal anti-AGT antibody is suitable to detect AGT in samples from Human. It has been validated for WB.

Quick Overview for AGT antibody (ABIN634787)

Target: AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AGT Antibody

Purification: Affinity purified

Immunogen: AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGT Blocking Peptide, (ABIN939371), is also available for use as a blocking control in assays to test for specificity of this AGT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGT

Target: AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))

Alternative Name: AGT

Background: AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, ACE Inhibitor Pathway, EGFR Signaling Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Regulation of Lipid Metabolism by PPARalpha, Protein targeting to Nucleus, Feeding Behaviour, Monocarboxylic Acid Catabolic Process, Dicarboxylic Acid Transport, Positive Regulation of Response to DNA Damage Stimulus, Regulation of long-term Neuronal Synaptic Plasticity