SLC39A10 antibody
-
- Target See all SLC39A10 Antibodies
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC39A10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC39 A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL
- Top Product
- Discover our top product SLC39A10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
- Alternative Name
- SLC39A10 (SLC39A10 Products)
- Synonyms
- LZT-Hs2 antibody, 2900042E17Rik antibody, 5430433I10 antibody, mKIAA1265 antibody, Slc39a10 antibody, Zip10 antibody, zgc:63552 antibody, DKFZp459C165 antibody, solute carrier family 39 member 10 antibody, solute carrier family 39 (zinc transporter), member 10 antibody, solute carrier family 39 (zinc transporter), member 4-like antibody, SLC39A10 antibody, Slc39a10 antibody, Slc39a4l antibody, slc39a10 antibody
- Background
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.
- Molecular Weight
- 94 kDa (MW of target protein)
-