OR6C75 antibody (Middle Region)
-
- Target See all OR6C75 Antibodies
- OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OR6C75 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OR6 C75 antibody was raised against the middle region of OR6 75
- Purification
- Affinity purified
- Immunogen
- OR6 C75 antibody was raised using the middle region of OR6 75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS
- Top Product
- Discover our top product OR6C75 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OR6C75 Blocking Peptide, catalog no. 33R-8330, is also available for use as a blocking control in assays to test for specificity of this OR6C75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))
- Alternative Name
- OR6C75 (OR6C75 Products)
- Synonyms
- olfactory receptor, family 6, subfamily C, member 75 antibody, olfactory receptor family 6 subfamily C member 75 antibody, OR6C75 antibody
- Background
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.
- Molecular Weight
- 35 kDa (MW of target protein)
-