ACMSD antibody (Middle Region)
-
- Target See all ACMSD Antibodies
- ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACMSD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACMSD antibody was raised against the middle region of ACMSD
- Purification
- Affinity purified
- Immunogen
- ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
- Top Product
- Discover our top product ACMSD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACMSD Blocking Peptide, catalog no. 33R-6822, is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACMSD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))
- Alternative Name
- ACMSD (ACMSD Products)
- Synonyms
- zgc:162888 antibody, ACMSD antibody, aminocarboxymuconate semialdehyde decarboxylase antibody, aminocarboxymuconate semialdehyde decarboxylase S homeolog antibody, amino carboxymuconate semialdehyde decarboxylase antibody, ACMSD antibody, acmsd antibody, acmsd.S antibody, Acmsd antibody
- Background
- The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.
- Molecular Weight
- 38 kDa (MW of target protein)
-