CMTM2 antibody (N-Term)

Catalog No. ABIN634911

Product Details anti-CMTM2 Antibody

Target: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMTM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CMTM2 antibody was raised against the N terminal of CMTM2

Purification: Affinity purified

Immunogen: CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CMTM2 Blocking Peptide, catalog no. 33R-2029, is also available for use as a blocking control in assays to test for specificity of this CMTM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMTM2

Target: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Alternative Name: CMTM2 (CMTM2 Products)

Synonyms: CKLFSF2 antibody, CKLF like MARVEL transmembrane domain containing 2 antibody, CMTM2 antibody

Background: CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.

Molecular Weight: 27 kDa (MW of target protein)