Cyclin M2 antibody (Middle Region)
-
- Target See all Cyclin M2 (CNNM2) Antibodies
- Cyclin M2 (CNNM2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cyclin M2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cyclin M2 antibody was raised against the middle region of CNNM2
- Purification
- Affinity purified
- Immunogen
- Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
- Top Product
- Discover our top product CNNM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin M2 (CNNM2)
- Alternative Name
- Cyclin M2 (CNNM2 Products)
- Synonyms
- acdp4 antibody, cnnm4 antibody, ACDP2 antibody, AU015877 antibody, AW048635 antibody, Acdp2 antibody, Clp2 antibody, cyclin and CBS domain divalent metal cation transport mediator 2 antibody, metal transporter CNNM2 antibody, cyclin M2 antibody, CNNM2 antibody, cnnm2 antibody, LOC100059801 antibody, Cnnm2 antibody
- Background
- CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.
- Molecular Weight
- 96 kDa (MW of target protein)
-