SLC25A36 antibody (N-Term)

Catalog No. ABIN634972

Product Details anti-SLC25A36 Antibody

Target: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A36 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A36 antibody was raised against the N terminal of SLC25 36

Purification: Affinity purified

Immunogen: SLC25 A36 antibody was raised using the N terminal of SLC25 36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A36 Blocking Peptide, catalog no. 33R-8854, is also available for use as a blocking control in assays to test for specificity of this SLC25A36 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A36

Target: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Alternative Name: SLC25A36 (SLC25A36 Products)

Synonyms: MGC131068 antibody, slc25a36b antibody, DKFZp459O044 antibody, slc25a36 antibody, slc25a36a antibody, PNC2 antibody, C330005L02Rik antibody, solute carrier family 25 member 36 antibody, solute carrier family 25 (pyrimidine nucleotide carrier), member 36 L homeolog antibody, solute carrier family 25 (pyrimidine nucleotide carrier), member 36 S homeolog antibody, solute carrier family 25, member 36 antibody, SLC25A36 antibody, slc25a36.L antibody, slc25a36.S antibody, Slc25a36 antibody

Background: SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.

Molecular Weight: 34 kDa (MW of target protein)