MOGAT2 antibody (Middle Region)
-
- Target See all MOGAT2 Antibodies
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MOGAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MOGAT2 antibody was raised against the middle region of MOGAT2
- Purification
- Affinity purified
- Immunogen
- MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN
- Top Product
- Discover our top product MOGAT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
- Alternative Name
- MOGAT2 (MOGAT2 Products)
- Synonyms
- mogat2 antibody, DGAT2L5 antibody, MGAT2 antibody, Mgat1l antibody, wu:fb94h05 antibody, zgc:101667 antibody, dgat2l5 antibody, mgat2 antibody, mogat2-b antibody, monoacylglycerol O-acyltransferase 2, gene 1 antibody, monoacylglycerol O-acyltransferase 2 antibody, monoacylglycerol O-acyltransferase 2, gene 1 L homeolog antibody, mogat2.1 antibody, MOGAT2 antibody, Mogat2 antibody, mogat2 antibody, mogat2.1.L antibody
- Background
- Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.
- Molecular Weight
- 38 kDa (MW of target protein)
-