ARV1 antibody
-
- Target See all ARV1 Antibodies
- ARV1 (ARV1 Homolog (ARV1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARV1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
- Top Product
- Discover our top product ARV1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARV1 Blocking Peptide, catalog no. 33R-7461, is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARV1 (ARV1 Homolog (ARV1))
- Alternative Name
- ARV1 (ARV1 Products)
- Synonyms
- 1110067L22Rik antibody, AI461928 antibody, AW121084 antibody, ARV1 homolog, fatty acid homeostasis modulator antibody, ARV1 antibody, Arv1 antibody
- Background
- ARV1 may act as a mediator of sterol homeostasis.
- Molecular Weight
- 31 kDa (MW of target protein)
-