SLC25A11 antibody
-
- Target See all SLC25A11 Antibodies
- SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM
- Top Product
- Discover our top product SLC25A11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A11 Blocking Peptide, catalog no. 33R-1955, is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))
- Alternative Name
- SLC25A11 (SLC25A11 Products)
- Synonyms
- SLC25A11 antibody, 2310022P18Rik antibody, 2oxoc antibody, fa07h09 antibody, wu:fa07h09 antibody, zgc:86898 antibody, OGC antibody, SLC20A4 antibody, solute carrier family 25 member 11 antibody, solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 antibody, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 antibody, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 L homeolog antibody, SLC25A11 antibody, Slc25a11 antibody, slc25a11 antibody, slc25a11.L antibody
- Background
- SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-