MS4A14 antibody (Middle Region)
-
- Target See all MS4A14 Antibodies
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MS4A14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NYD-SP21 antibody was raised against the middle region of Nyd-Sp21
- Purification
- Affinity purified
- Immunogen
- NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV
- Top Product
- Discover our top product MS4A14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NYD-SP21 Blocking Peptide, catalog no. 33R-7792, is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
- Alternative Name
- NYD-SP21 (MS4A14 Products)
- Synonyms
- Sp3111 antibody, Gm1276 antibody, SP3111 antibody, NYD-SP21 antibody, MGC137320 antibody, MS4A16 antibody, membrane spanning 4-domains A14 antibody, membrane-spanning 4-domains, subfamily A, member 14 antibody, Ms4a14 antibody, MS4A14 antibody
- Background
- NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.
- Molecular Weight
- 76 kDa (MW of target protein)
-