SLC1A2 antibody
-
- Target See all SLC1A2 Antibodies
- SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC1A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC1 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
- Top Product
- Discover our top product SLC1A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC1A2 Blocking Peptide, catalog no. 33R-7118, is also available for use as a blocking control in assays to test for specificity of this SLC1A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))
- Alternative Name
- SLC1A2 (SLC1A2 Products)
- Synonyms
- CG3159 antibody, Dmel\\CG3159 antibody, EAAT antibody, dEAAT2 antibody, dEaat2 antibody, Eaat antibody, GB16377 antibody, EAAT2 antibody, SLC1A2 antibody, Eaat2 antibody, Glt antibody, Glt-1 antibody, GLT-1 antibody, 1700091C19Rik antibody, 2900019G14Rik antibody, AI159670 antibody, GLT1 antibody, MGLT1 antibody, eaat2 antibody, fj34b12 antibody, slc1a2 antibody, wu:fj34b12 antibody, zgc:65897 antibody, Excitatory amino acid transporter 2 antibody, excitatory amino acid transporter 2 antibody, solute carrier family 1 member 2 antibody, solute carrier family 1 (glial high affinity glutamate transporter), member 2 antibody, solute carrier family 1 (glial high affinity glutamate transporter), member 2b antibody, Eaat2 antibody, Eaat-2 antibody, SLC1A2 antibody, VDBG_06180 antibody, EUBELI_01747 antibody, Trebr_0139 antibody, Slc1a2 antibody, slc1a2b antibody
- Background
- SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-