SLC15A4 antibody (Middle Region)
-
- Target See all SLC15A4 Antibodies
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC15A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC15 A4 antibody was raised against the middle region of SLC15 4
- Purification
- Affinity purified
- Immunogen
- SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
- Top Product
- Discover our top product SLC15A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
- Alternative Name
- SLC15A4 (SLC15A4 Products)
- Synonyms
- bZ1L10.1 antibody, zgc:56484 antibody, zgc:63767 antibody, pht1 antibody, ptr4 antibody, MGC80026 antibody, PHT1 antibody, PTR4 antibody, AA987064 antibody, AW742963 antibody, C130069N12Rik antibody, solute carrier family 15 (oligopeptide transporter), member 4 antibody, solute carrier family 15 member 4 antibody, solute carrier family 15 member 4 L homeolog antibody, solute carrier family 15, member 4 antibody, slc15a4 antibody, SLC15A4 antibody, slc15a4.L antibody, Slc15a4 antibody
- Background
- SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
- Molecular Weight
- 62 kDa (MW of target protein)
-