RNF121 antibody (Middle Region)
-
- Target See all RNF121 Antibodies
- RNF121 (Ring Finger Protein 121 (RNF121))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF121 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF121 antibody was raised against the middle region of RNF121
- Purification
- Affinity purified
- Immunogen
- RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC
- Top Product
- Discover our top product RNF121 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF121 Blocking Peptide, catalog no. 33R-3438, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF121 (Ring Finger Protein 121 (RNF121))
- Alternative Name
- RNF121 (RNF121 Products)
- Synonyms
- 4930544L10Rik antibody, im:6907121 antibody, si:ch73-373k7.1 antibody, ring finger protein 121 antibody, RING finger protein 121 antibody, RNF121 antibody, rnf-121 antibody, Rnf121 antibody, rnf121 antibody
- Background
- The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-