SLC6A15 antibody
-
- Target See all SLC6A15 Antibodies
- SLC6A15 (Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC6A15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC6 A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS
- Top Product
- Discover our top product SLC6A15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC6A15 Blocking Peptide, catalog no. 33R-10141, is also available for use as a blocking control in assays to test for specificity of this SLC6A15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A15 (Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15))
- Alternative Name
- SLC6A15 (SLC6A15 Products)
- Synonyms
- B0AT2 antibody, AA536730 antibody, AI326450 antibody, AI326451 antibody, v7-3 antibody, NTT73 antibody, SBAT1 antibody, V7-3 antibody, hv7-3 antibody, Ntt73 antibody, solute carrier family 6 (neutral amino acid transporter), member 15 antibody, solute carrier family 6 member 15 antibody, hypothetical protein antibody, solute carrier family 6 (neurotransmitter transporter), member 15 antibody, SLC6A15 antibody, Slc6a15 antibody, slc6a15 antibody
- Background
- SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.
- Molecular Weight
- 82 kDa (MW of target protein)
-