SLCO1A2 antibody (Middle Region)
-
- Target See all SLCO1A2 Antibodies
- SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLCO1A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLCO1 A2 antibody was raised against the middle region of SLCO1 2
- Purification
- Affinity purified
- Immunogen
- SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC
- Top Product
- Discover our top product SLCO1A2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLCO1A2 Blocking Peptide, catalog no. 33R-1268, is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))
- Alternative Name
- SLCO1A2 (SLCO1A2 Products)
- Synonyms
- OATP antibody, OATP-A antibody, OATP1A2 antibody, SLC21A3 antibody, Oatp2 antibody, Slc21a5 antibody, Slco1a4 antibody, solute carrier organic anion transporter family member 1A2 antibody, solute carrier organic anion transporter family, member 1A2 antibody, SLCO1A2 antibody, Slco1a2 antibody
- Background
- SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.
- Molecular Weight
- 64 kDa (MW of target protein)
-