SSR1 antibody (Middle Region)

Catalog No. ABIN635192

Product Details anti-SSR1 Antibody

Target: SSR1 (Signal Sequence Receptor, alpha (SSR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SSR1 antibody was raised against the middle region of SSR1

Purification: Affinity purified

Immunogen: SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSR1

Target: SSR1 (Signal Sequence Receptor, alpha (SSR1))

Alternative Name: SSR1 (SSR1 Products)

Synonyms: cb758 antibody, trapa antibody, Ssr1 antibody, TRAPA antibody, 2510001K09Rik antibody, 6330400D04 antibody, AI159733 antibody, AI452176 antibody, SSR antibody, signal sequence receptor, alpha antibody, signal sequence receptor, alpha (translocon-associated protein alpha) antibody, signal sequence receptor subunit 1 antibody, signal sequence receptor, alpha (translocon-associated protein alpha) S homeolog antibody, ssr1 antibody, SSR1 antibody, Ssr1 antibody, ssr1.S antibody

Background: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling