MPZL1 antibody (Middle Region)
-
- Target See all MPZL1 Antibodies
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPZL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MPZL1 antibody was raised against the middle region of MPZL1
- Purification
- Affinity purified
- Immunogen
- MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
- Top Product
- Discover our top product MPZL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPZL1 Blocking Peptide, catalog no. 33R-4168, is also available for use as a blocking control in assays to test for specificity of this MPZL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
- Alternative Name
- MPZL1 (MPZL1 Products)
- Synonyms
- MPZL1 antibody, MPZL1b antibody, PZR antibody, PZR1b antibody, PZRa antibody, PZRb antibody, 1110007A10Rik antibody, myelin protein zero like 1 antibody, myelin protein zero-like 1 antibody, MPZL1 antibody, Mpzl1 antibody
- Background
- MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.
- Molecular Weight
- 23 kDa (MW of target protein)
-