SIGIRR antibody

Catalog No. ABIN635203

This Rabbit Polyclonal antibody specifically detects SIGIRR in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SIGIRR antibody (ABIN635203)

Target: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGIRR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SIGIRR Antibody

Purification: Affinity purified

Immunogen: SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGIRR Blocking Peptide, (ABIN5616143), is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGIRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGIRR

Target: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Alternative Name: SIGIRR

Background: SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades