LPCAT1 antibody (Middle Region)
-
- Target See all LPCAT1 Antibodies
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LPCAT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LPCAT1 antibody was raised against the middle region of LPCAT1
- Purification
- Affinity purified
- Immunogen
- LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
- Top Product
- Discover our top product LPCAT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LPCAT1 Blocking Peptide, catalog no. 33R-5370, is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
- Alternative Name
- LPCAT1 (LPCAT1 Products)
- Synonyms
- AYTL2 antibody, Aytl2 antibody, RGD1311599 antibody, PFAAP3 antibody, lpcat antibody, si:dkey-261i16.4 antibody, zgc:158232 antibody, 2900035H07Rik antibody, BB137372 antibody, BC005662 antibody, C87117 antibody, LPCAT antibody, rd11 antibody, lysophosphatidylcholine acyltransferase 1 antibody, LPCAT1 antibody, Lpcat1 antibody, lpcat1 antibody
- Background
- Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.
- Molecular Weight
- 59 kDa (MW of target protein)
-