MPG antibody (C-Term)

Catalog No. ABIN635211

Product Details anti-MPG Antibody

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPG antibody was raised against the C terminal of MPG

Purification: Affinity purified

Immunogen: MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPG Blocking Peptide, catalog no. 33R-4919, is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPG

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Alternative Name: MPG (MPG Products)

Synonyms: AAG antibody, ADPG antibody, APNG antibody, CRA36.1 antibody, MDG antibody, Mid1 antibody, PIG11 antibody, PIG16 antibody, anpg antibody, 9830006D05 antibody, AI326268 antibody, Aag antibody, zgc:162984 antibody, si:xx-187g17.9 antibody, MPG antibody, MPGR antibody, N-methylpurine DNA glycosylase antibody, N-methylpurine-DNA glycosylase antibody, si:xx-by187g17.9 antibody, MPG antibody, Mpg antibody, mpg antibody, si:xx-by187g17.9 antibody, CpB0526 antibody, gll2491 antibody

Background: MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: DNA Damage Repair