RNF182 antibody (Middle Region)
-
- Target See all RNF182 Antibodies
- RNF182 (Ring Finger Protein 182 (RNF182))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF182 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF182 antibody was raised against the middle region of RNF182
- Purification
- Affinity purified
- Immunogen
- RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
- Top Product
- Discover our top product RNF182 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF182 (Ring Finger Protein 182 (RNF182))
- Alternative Name
- RNF182 (RNF182 Products)
- Synonyms
- C630023L15Rik antibody, RGD1560399 antibody, ring finger protein 182 antibody, ring finger protein 182 L homeolog antibody, RNF182 antibody, Rnf182 antibody, rnf182.L antibody
- Background
- RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
- Molecular Weight
- 27 kDa (MW of target protein)
-